🎉 Orders $200+ Get Free Domestic Shipping!

Semaglutide

Semaglutide is a GLP-1 receptor agonist developed as a research compound for the study of metabolic function, appetite regulation, and insulin sensitivity. It mimics the action of the endogenous incretin hormone GLP-1 but has been chemically modified for enhanced stability and prolonged activity.

In research environments, Semaglutide has demonstrated potent effects in lowering blood glucose levels, promoting satiety, and reducing body weight. These results have made it a key compound in studies on obesity, type 2 diabetes, and non-alcoholic fatty liver disease (NAFLD). It is also being explored for its potential neuroprotective properties in neurological and cognitive disorders.

Semaglutide operates through a well-characterized mechanism of enhancing insulin secretion and slowing gastric emptying, and has shown systemic benefits across multiple organ systems. Although approved for therapeutic use in some regulated clinical settings, this product is sold strictly for in-vitro research purposes and is not approved for human or veterinary use.

Peptides will arrive in a lyophilized (powder) form for maximum stability

$119.97

Quantity

🧬 Overview

Semaglutide is a synthetic glucagon-like peptide-1 (GLP-1) receptor agonist developed for experimental research in metabolic regulation. As a modified version of the human GLP-1 analog, Semaglutide is designed for enhanced half-life and receptor affinity in laboratory models. It has been widely studied in rodent and primate systems for its potential role in glucose homeostasis, insulin response, and pancreatic beta-cell function under various metabolic conditions.

⚙️ Mechanism of Action

Semaglutide binds to and activates the GLP-1 receptor, a key component in the regulation of glucose metabolism. In animal studies, its activity has been associated with stimulated insulin secretion, suppressed glucagon release, delayed gastric emptying, and altered appetite-related signaling. Its extended half-life allows for sustained receptor engagement, making it a candidate of interest in long-term studies of endocrine signaling and metabolic feedback mechanisms.

🧪 Key Research Focus Areas

Preclinical models using Semaglutide have examined its effects on glycemic control, insulin resistance, lipid metabolism, and pancreatic islet preservation. Additional studies in rodents and non-human primates have evaluated its role in hepatic glucose production, appetite-regulating pathways, and cardiovascular biomarkers. Research continues into its impact on hypothalamic signaling, satiety modulation, and systemic metabolic markers in experimental disease models.

⏳ Long-Term Experimental Potential

Long-term animal trials have assessed Semaglutide’s influence on weight regulation, atherosclerotic markers, and inflammatory cytokine expression in metabolic stress scenarios. The compound’s stability and prolonged biological activity make it suitable for chronic intervention studies. Researchers remain focused on its applications in metabolic syndrome models and endocrine tissue plasticity research.

🧫 Safety & Tolerability (Research Use Only)

Semaglutide has demonstrated high tolerability in controlled animal studies, with predictable pharmacokinetics and minimal adverse effects in standard dosing environments. This product is not approved for human or veterinary use. It is intended strictly for in vitro and preclinical research purposes only. All laboratory use must comply with legal and institutional ethical standards.

🧬 Sequencing & Structural Data

  • Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG — Lys26(AEEAc-Aib-Glu-2xC18 fatty diacid)
  • Molecular Formula: C187H291N45O59
  • Molecular Weight: 4113.58 g/mol
  • CAS Number: 910463-68-2
  • PubChem CID: 56843331
  • Synonyms: Semaglutide Acetate, GLP-1(7-37) analog, NN9535

📚 References

  1. https://pubmed.ncbi.nlm.nih.gov/25859590/
  2. https://pubmed.ncbi.nlm.nih.gov/27768866/
  3. https://pubmed.ncbi.nlm.nih.gov/29642969/
  4. https://pubmed.ncbi.nlm.nih.gov/31082660/
  5. https://pubmed.ncbi.nlm.nih.gov/27373175/

⚠️ Legal Disclaimer

ALL ARTICLES AND PRODUCT INFORMATION PROVIDED ON THIS WEBSITE ARE FOR INFORMATIONAL AND EDUCATIONAL PURPOSES ONLY.

The products offered on this website are furnished for in-vitro laboratory research only. In-vitro studies (Latin: “in glass”) are performed outside of living organisms. These products are not medicines or drugs, and they have not been approved by the FDA to prevent, treat, or cure any medical condition, ailment, or disease. Under no circumstances should these products be introduced into the human or animal body, whether by injection, ingestion, topical application, or any other route. Bodily introduction is strictly prohibited by law.

Subscribe to our newsletter

Want to get 15% OFF site-wide plus a FREE keychain? Subscribe to our newsletter to claim this offer!

Please wait...

Thank you for subscribing!